PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_58272.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 354aa    MW: 38970.5 Da    PI: 7.8262
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_58272.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.94.1e-53151422129
           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                   p GfrFhPtd e+++ yL +kv +k +++  ++ evd++k+ePw+Lp+k++ +ekewyfFs++d+ky+tg r+nrat++gyWkatgkdkev+++ ++
  MLOC_58272.1  15 PTGFRFHPTDVEIITSYLVPKVLNKAFNA-IAVGEVDLNKCEPWELPEKANMGEKEWYFFSQKDRKYPTGIRTNRATAAGYWKATGKDKEVFHQaTT 110
                   89************************999.88***************99999*****************************************9777 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                   +l+g+kktLvfy grap+gekt+Wvmheyrle
  MLOC_58272.1 111 SLIGMKKTLVFYMGRAPRGEKTNWVMHEYRLE 142
                   88****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-585177IPR003441NAC domain
PROSITE profilePS5100555.94814177IPR003441NAC domain
PfamPF023652.0E-2715141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MADHIQVQRQ QLKFPTGFRF HPTDVEIITS YLVPKVLNKA FNAIAVGEVD LNKCEPWELP  60
EKANMGEKEW YFFSQKDRKY PTGIRTNRAT AAGYWKATGK DKEVFHQATT SLIGMKKTLV  120
FYMGRAPRGE KTNWVMHEYR LESGKQGTPG LPTDITTAAA INASSKEEYV VCRIFHKSTG  180
LKKVVMSSYA IPMPMSMGAA QQHGFLESGA LPSLMGYGTS SSSPAPPSLL PAASSYQLHN  240
VGVSSSMMGS AMLPMMNDHY FGNHHYQKMP TPPQPLMSSY HQDHHQQQQQ LIQMPMQMQM  300
GADEGLMVGV EPGSGPSSIL SQEDTVTGLS SNGVGTTADE ISSMNIGMDG MLKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-501118314171NO APICAL MERISTEM PROTEIN
1ut4_B2e-501118314171NO APICAL MERISTEM PROTEIN
1ut7_A2e-501118314171NO APICAL MERISTEM PROTEIN
1ut7_B2e-501118314171NO APICAL MERISTEM PROTEIN
3swm_A2e-501118317174NAC domain-containing protein 19
3swm_B2e-501118317174NAC domain-containing protein 19
3swm_C2e-501118317174NAC domain-containing protein 19
3swm_D2e-501118317174NAC domain-containing protein 19
3swp_A2e-501118317174NAC domain-containing protein 19
3swp_B2e-501118317174NAC domain-containing protein 19
3swp_C2e-501118317174NAC domain-containing protein 19
3swp_D2e-501118317174NAC domain-containing protein 19
4dul_A2e-501118314171NAC domain-containing protein 19
4dul_B2e-501118314171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565350.19e-87PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FLJ29e-78NC100_ARATH; NAC domain-containing protein 100
TrEMBLM0XA330.0M0XA33_HORVD; Uncharacterized protein
STRINGMLOC_58272.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.13e-77NAC domain containing protein 100